PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.D7N1Q
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NAC
Protein Properties Length: 142aa    MW: 16127.6 Da    PI: 10.3197
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.D7N1QgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM131.85e-41111211128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kg 97 
                  lppGfrFhP+deel+v+yL++kv++++l++ ++i+e+d+yk++Pw+Lp                 +ky++g r+nra+ +gyWkatg+dk+++++ + 
  Araip.D7N1Q  11 LPPGFRFHPSDEELIVHYLRNKVTSSPLPA-SFIAEIDLYKFNPWELP-----------------RKYPNGVRPNRAAGAGYWKATGTDKPIITScGM 90 
                  79****************************.89**************9.................68**************************99778 PP

          NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                  + +g+kk Lvfykgr pkg+ktdW+mheyrl
  Araip.D7N1Q  91 KSIGVKKALVFYKGRPPKGSKTDWIMHEYRL 121
                  88***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-498127IPR003441NAC domain
PROSITE profilePS5100540.2311142IPR003441NAC domain
PfamPF023656.8E-2412121IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 142 aa     Download sequence    Send to blast
MDKDTSLEIH LPPGFRFHPS DEELIVHYLR NKVTSSPLPA SFIAEIDLYK FNPWELPRKY  60
PNGVRPNRAA GAGYWKATGT DKPIITSCGM KSIGVKKALV FYKGRPPKGS KTDWIMHEYR  120
LHDSLLSNSH KRGSMRVGQL HP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-5021216140Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1286381e-40AC128638.34 Medicago truncatula clone mth2-36h10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016207623.13e-93PREDICTED: NAC transcription factor 29-like
SwissprotO492551e-61NAC29_ARATH; NAC transcription factor 29
TrEMBLA0A0B2NYY26e-83A0A0B2NYY2_GLYSO; NAC domain-containing protein 29
TrEMBLK7KP261e-83K7KP26_SOYBN; Uncharacterized protein
TrEMBLK7MZ046e-83K7MZ04_SOYBN; Uncharacterized protein
STRINGGLYMA05G15533.14e-83(Glycine max)
STRINGGLYMA19G36421.12e-82(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF24162981
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.18e-63NAC-like, activated by AP3/PI